SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347539233|ref|YP_004846658.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347539233|ref|YP_004846658.1|
Domain Number 1 Region: 136-559
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.57e-124
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000109
Further Details:      
 
Domain Number 2 Region: 43-136
Classification Level Classification E-value
Superfamily Cytochrome c 6.07e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347539233|ref|YP_004846658.1|
Sequence length 559
Comment nitrite reductase (NO-forming) NirS [Pseudogulbenkiania sp. NH8B]
Sequence
MAALPLAVTAAFAAPPGASAPELAYQAGGSPLAGQEMHQNINPKAPPMTKAEFAQARQIY
FERCAGCHGVLRKGATGKPLTTDITLERGTEYLKTFIKYGSPAGMPNWGTSGELSDVQVD
LMARYVQQEPPTPPEYSLADIEKTRKVLIPVDKRPTKKMNKYNLDNLFSVTLRDSGEIAL
IDGDSKQIISIIKTGYAVHISRVSASGRYLYVIGRDAKINLIDLWMEHPETVAEIKVGLE
ARSVETSKFKGWEDKIAVAGTYWPPQYVIMDGDTLKPQKVVSTRGMTVDNEYHPEPRVAS
IVSSHYKPEFVINAKETGKIMMVNYSDLNNLKTTTINAAKFLHDGGFDRTGRYFFVAANA
SNKIAVVDTKEDKLAGLVDVGKTPHPGRGANFVHPKFGPVWATGHLGDDSIALIGSDPVK
HKQYAWKMVASIQGQGGGSLFIKTHPKSKNLWVDTTLNPDSSVSQSVAVYDIDHLDKGFV
RLPVGEWAGLGDGAKRVVQPEYNKAGDEVWFSVWSAKDKQSAIVVVDDKTRKLKAVIKDP
RLVTPTGKFNVFNTQHDIY
Download sequence
Identical sequences G2J1R6
gi|347539233|ref|YP_004846658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]