SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347539242|ref|YP_004846667.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347539242|ref|YP_004846667.1|
Domain Number 1 Region: 102-282,318-506
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.75e-78
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0001
Further Details:      
 
Domain Number 2 Region: 9-105
Classification Level Classification E-value
Superfamily Cytochrome c 3.95e-21
Family monodomain cytochrome c 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347539242|ref|YP_004846667.1|
Sequence length 513
Comment cytochrome d1 heme region NirN [Pseudogulbenkiania sp. NH8B]
Sequence
MKALLPLALLAALGSLQPASANPAALYQQHCQSCHGDNRMGAMAPALLPQSLERLKPAEI
LDTIRHGRSATQMPAFAERLADADIQALAGYLKTAPEQPARWSDADTAASRVVYADPARL
PAKPVHRADPQNLFVVVEAGDHHVSVLDGDTLSPIARFQSRFALHGGPKFSPDGRFVYFA
SRDGWVTQYDLYTLQNVAEIRVGLNTRNVAVSSDGRWVLAGNTLPETLVLLDANGLKPVK
TLAVQDAAGKTSRVSAVYDAAPRHSFIVALKDVPELWEISYDPKAARVYPGHVHDYKMGE
ALSVDGFLNPRVTPLDLVLDDFFFDPAYRHVIGASREGRAQVINLDIRRKVAELPLDGMP
HLGSGIAFEEGGHRYMATPNLSSGRVTVIDLDSWQRVKDIPTLGPGFFLRSHENTPYAWV
DAMMGAKKDTLAIIDKRTLEVVKTVTPRPGKTTAHVEFTRDGRYALVSVMENPGELLVLD
AATFREVKSLPMAKPIGKYNVFNKVTRSEGTSH
Download sequence
Identical sequences G2J1S5
WP_014086640.1.76262 gi|347539242|ref|YP_004846667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]