SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347539418|ref|YP_004846843.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347539418|ref|YP_004846843.1|
Domain Number 1 Region: 41-317
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.14e-55
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347539418|ref|YP_004846843.1|
Sequence length 325
Comment putative transmembrane protein [Pseudogulbenkiania sp. NH8B]
Sequence
MLQEKKPYAVVAALLLTGLAHAAPAFDGQIRNNTLAVNPAETLALAAKSDSDKVYVYDLR
SGKMRQALEGFISPRNILFSPDGQSFYISDSTKGTIEKWDSASLTRSASMAVGPGAFGTT
LSRDGSRLFVNNQATSTVTAFDPATLQPLAVMTGFAQPRQGIKLSADDKALFVTNFLGDK
ITVVDPSGFKPLAEIGGFNKIRAIAISHDGKTLYAANSGSDTLAEVDVEGRYVRRSVKVG
SDPYGAALRPDGRFLYSGNLKGNSMTIVSLPDFKVTGEIGGLHGPRQAISFSHDSHKAWV
LNEDVSIAEVDLTARRITRTLTPGS
Download sequence
Identical sequences G2J2Q3
WP_014086793.1.76262 gi|347539418|ref|YP_004846843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]