SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347539718|ref|YP_004847143.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347539718|ref|YP_004847143.1|
Domain Number 1 Region: 273-448,587-682,751-829
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-26
Family ABC transporter ATPase domain-like 0.027
Further Details:      
 
Domain Number 2 Region: 39-156
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000687
Family PHP domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347539718|ref|YP_004847143.1|
Sequence length 884
Comment ATPase [Pseudogulbenkiania sp. NH8B]
Sequence
MSDQYTYARFWRCALQVNPVGYNGTYRGANHGLDEDGYNQALLQKCLELGIAVVGLADHG
SVASVDALRQVLQPYGIVVFPGFEIASNDKTHYVCLFPEDTTVQQLDRYLGNLKLHDPAD
GIRPSRLSSEELIAEVDLLGGFIYAAHCTQESGLLKNRLNHVWKHPKLRAAQIPGSIDDL
TSIEGDFYRKVFLNKDDGYRRERPVAAINAKDVAKPDDLDQPSATCFIKMTRPTFAAFKV
AFLDPGSRVRLNSQQAQSPIGKVVRMTVAGGYLDGVRVDFSDHLNTVIGGRGTGKSTLLE
CLRFALDFPPKGKQAHKLHQEIIRENLGRSAGRVELTVVSSAQNGKQYIISRRYGEPPMV
HDMDGNISTLLPRDLLPGIDIYGQNEIYELAQDEASRVQLLDRFLPQDGEYEAKSADVHR
RLKDNQQKLTKSLTDLDELNAQVERLPKLEEQLRGFDELGIKEKLAKTSLLACEREIAKT
ATDGVQSFRDALSELRDSLPDLAFINDEALEGLPDAAQLLAMRTMLNGLKQGFTDHLTAM
QALLDEKAGQFFTQHGAWQQAIQGHDAELEKTLRTLPATAGKSGQEVGVAYQKLMGEIER
IKPMKSRATTHESQRDTLRQERRNLLAELSDLRGQRIQALQKAAKRLNKRLEGKLKVEIV
PEADRTPLMTFLLGCKLDGVGEKRLAFIAEAETISPLSLAQSIQKGSADVQLDWGVTQMV
ADALTKLQSHQLMELEALELEHRVDIFLNVAHGQADPVFRPLNKLSTGQQCTAILHMLLL
ENVDPLLMDQPEDNLDNAFIADRIVAELREAKTSRQFLFATHNANIPVFGDAEWIGVFTA
AENQGCLGLEAQGSIDVPVIRDQVASILEGGRDAFIQRKEKYEF
Download sequence
Identical sequences G2J3T4
gi|347539718|ref|YP_004847143.1| WP_014087066.1.76262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]