SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332670053|ref|YP_004453061.1| from Cellulomonas fimi ATCC 484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332670053|ref|YP_004453061.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-44
Family Ribonuclease PH domain 1-like 0.000000409
Further Details:      
 
Domain Number 2 Region: 321-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-43
Family Ribonuclease PH domain 1-like 0.000000389
Further Details:      
 
Domain Number 3 Region: 153-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.07e-27
Family Ribonuclease PH domain 2-like 0.0000104
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.71e-23
Family Ribonuclease PH domain 2-like 0.0000169
Further Details:      
 
Domain Number 5 Region: 576-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 265-345
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.42e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332670053|ref|YP_004453061.1|
Sequence length 742
Comment guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [Cellulomonas fimi ATCC 484]
Sequence
MEGPEIQFAEAVIDNGRFGTRTVRFETGRLAKQAAGSAAAYLDGETMLLSATTAGKHPKD
QFDFFPLTIDVEERQYAAGKIPGSFFRREGRPSTEAILACRLVDRPLRPLFVKGLRNEVQ
VVITVLAIHPDDAYDTLAINAASISTQLSGLPFSGPVGGVRIALVDGQWVAFPRYSERER
ATFDMVVAGRVVGDDVAIAMIEAEAPEKSWNLIQEGATAPTEEVVAQGLEAAKPFIKVLV
EAQQELAAKAAKETQVFPTFPDYQDDAFAAVEAAATTSLGEALSIADKQTRENRLDEIKA
EVVGQLAEQFEGREKELSAAYRSVQKKLIRQRILTDGFRIDGRGLRDIRTLSAEVEVLPR
VHGSAIFERGETQILGVTTLNMLRMEQQLDTLSPETRKRYMHNYNFPPYSTGETGRVGSP
KRREIGHGALAERALMPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSLLNAGVP
LRAPVAGIAMGLVSDTVDGETRYAALTDILGAEDAFGDMDFKVAGTREFVTAIQLDTKLD
GIPASVLGGALTQAKEARLAILDVIAEAIDVPDEMSPFAPRVITVKVPVDKIGEVIGPKG
KMINQIQEETGADISIEDDGTVYIGATDGPSAEAARAAINAIANPHMPEVGERFVGTVVK
TTTFGAFVSLSPGKDGLLHISQIRKLVGGKRVENVEDVLSVGQKVQVEIGEIDPRGKLSL
HAVIEEDAAAEAPAESAAAADA
Download sequence
Identical sequences F4H740
WP_013770700.1.46799 gi|332670053|ref|YP_004453061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]