SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319957294|ref|YP_004168557.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319957294|ref|YP_004168557.1|
Domain Number 1 Region: 110-465,507-559
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.57e-61
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000164
Further Details:      
 
Domain Number 2 Region: 12-103
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000000045
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319957294|ref|YP_004168557.1|
Sequence length 569
Comment dissimilatory nitrite reductase (no-forming), cytochrome Cd1 type apoprotein [Nitratifractor salsuginis DSM 16511]
Sequence
MKLGTVLSYVAAVSLAATMAQAGTSKMDFAKVYEKECQGCHGPIHQGGVGADLRPKALKK
KNKQMLVDTILEGRPGTAMPAWKSKFSRDDAAGMVDWLMNWKNTVELKLDLDQIKKSWKK
LADREALFKKYPTPTDVKSVKDIVFATERDASLVDFIDGTTGKVLSRHKAGFAVHVTVTN
KRMPRYAYSISRSGRLTMFDLNAPGQPAIASVQVGQESRGLAVSPDGKYVMAGDYNPGGA
VLCDAKTLEPLKVYPTSSVIDPDGNIGPSRVAYIADTPYAPYFSFALKDGGHVYIVDYSK
PDFPVVGDIPNIGKILHDAFENEGVDEGRFVYVASQGSDLMGVVDLKTKKLAAKIYTGPG
TKPHPGQGSSWYNDKYGQLNATNSMNVGDVVIWNMDNKVVANVPTAGGGLFVGTSKDTPY
LWSDCVLGGPHNYNKVYLINKQTLKTDRIIEVGKTKGHLIDAHTGKILQEWDATQYQTVK
GKQVSSKISKETLLTYTAKHGPKVKNPVVPRLLHAEPANHGKWTFISEWTTGRIGVYESE
TGKFVKYIYNMTTPTFTYSVEHRQEVPGA
Download sequence
Identical sequences E6X0F8
WP_013554497.1.35362 gi|319957294|ref|YP_004168557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]