SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319956216|ref|YP_004167479.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319956216|ref|YP_004167479.1|
Domain Number 1 Region: 329-518
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-46
Family Ribonuclease PH domain 1-like 0.0000712
Further Details:      
 
Domain Number 2 Region: 10-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-38
Family Ribonuclease PH domain 1-like 0.0002
Further Details:      
 
Domain Number 3 Region: 483-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.82e-23
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 270-357
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.97e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0074
Further Details:      
 
Domain Number 5 Region: 586-677
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.15e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 145-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.000000000000767
Family Ribonuclease PH domain 2-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319956216|ref|YP_004167479.1|
Sequence length 729
Comment polyribonucleotide nucleotidyltransferase [Nitratifractor salsuginis DSM 16511]
Sequence
MQEKIIEITSNGLQESFTLGKVARQTDGSVLYRQGKTMILATVVSSDKAVHEPFLPLTVQ
YIEKAYAAAKIPGGFVKRESKPSDFETLTSRIIDRSLRPLFPEDFAYPTVITVLVLSADS
EVDLQVAALHAANAALLVSDLPVERSVAAVRLGKIDGERRLNPPLSRMEESALDLLLVGS
GEELLMIEMAAKATEVIEVEEIPEPELLMGPMPVLLPHQESNELPEEELIALIGEARGEI
AEACRRYEEALRPFKAEIREFPPVIDRAELEDLTALVREQFSDRIASALAGLSKSERADI
IDEVVQEVEAYLVEHGIHREPLVVYRAIEAVKREMLRRQILEEGVRPDGRKPDEVRPISI
ETNLLPSVHGSCLFTRGETQALATVTLGEGKEGQLYELLTERSPRTERFMVHYNFPPFCV
GEARPIGAPSRRELGHGNLAKRALEPVIDRELSRTIRLVSEILESNGSSSMATVCAGSLA
LVSAEAEISALVAGVAMGLVKEGDRHRVLTDIMGLEDHDGDMDFKVAGTRKGITAMQLDI
KLGGLDLEILSEALTQAKKARFHILDLMEEAQKSIVPSAALPVAEHFHIDPSKIVHVIGK
AGSTIREIIEKFEVKIDMDREKGKVKVTGADREKVKAAREHIEGIASREEPKVPKYEVGA
TYQGTVKRIADYGLFVELPGADTMRCSIAPKCRAKALQISNRVMRSKSRYSVSRIARWSW
LFPNIRVER
Download sequence
Identical sequences E6X0E1
WP_013553426.1.35362 gi|319956216|ref|YP_004167479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]