SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331698942|ref|YP_004335181.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331698942|ref|YP_004335181.1|
Domain Number 1 Region: 1-402
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 4.11e-72
Family Gtf glycosyltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331698942|ref|YP_004335181.1|
Sequence length 423
Comment MGT family glycosyltransferase [Pseudonocardia dioxanivorans CB1190]
Sequence
MSTFLVYTPPAAGHVFPLVPGLRALAARGHRVHLRTSPELAAQLTAAGIIGGRLEASAVD
PRISAHVAASHDPGGRHVDELSDLLARSAWEAQDLHAAVATVRPDALLVDANTYGAATAA
QTTGLPWATVVPSVLPYPGAGIPPYGMGLRPRTGPWGALRDAVLWKVVEKAFGKALLPGL
NDVRRAEGLPALRSPLEYVPGADRVLVLTGEPLEYPRTDLPAHVRIVGGQPWDPPADEPA
WLAEPGEPWVLVTCSTHYQGDEALAATAIEALRDEPVRVVVTLAGAYDSATLPQAPRVRV
ERFVPHAAVLARAAAVVCPSGMGIVTKAVAAGVPVVAVPFGRDQPEVARRVAQAGTGVVL
PARRLDAARLRRAVRSAIALRDRARAVAATIPPGDAAAARFADAAGELLGLRAGRSAPST
CPA
Download sequence
Identical sequences F4CRW1
WP_013677234.1.25045 gi|331698942|ref|YP_004335181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]