SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331695395|ref|YP_004331634.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331695395|ref|YP_004331634.1|
Domain Number 1 Region: 90-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.62e-25
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.3e-18
Family GntR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|331695395|ref|YP_004331634.1|
Sequence length 259
Comment GntR family transcriptional regulator [Pseudonocardia dioxanivorans CB1190]
Sequence
MSAADRAIQKIRDLIVEGQLGPGYRLPAESELAAKLQVSRNALREAVRALCEARVLEIRR
GDGTFVSNLQPETLLGGLGFALDLMHDGTLLEIFEVRRLLEPAATGLAAQRATDEDITIL
TKSLHRLNDARDDEELIAFDLEFHRQVVSITGNATLCTLMDAIGKRAINARVARGVIQQG
TKNFTFEQHSRIVEAIIARDPFLASAASTVHVSASESWLRHALDPARTKDGPADVFTQQR
LHAMQQSADRPDGPDDGRS
Download sequence
Identical sequences F4CVG1
gi|331695395|ref|YP_004331634.1| WP_013673714.1.25045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]