SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333991093|ref|YP_004523707.1| from Mycobacterium sp. JDM601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333991093|ref|YP_004523707.1|
Domain Number 1 Region: 65-135
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 4.58e-26
Family Iron-dependent repressor protein, dimerization domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 130-230
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 7.55e-22
Family FeoA-like 0.0000203
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000201
Family Iron-dependent repressor protein 0.0000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333991093|ref|YP_004523707.1|
Sequence length 230
Comment iron-dependent repressor and activator IdeR [Mycobacterium sp. JDM601]
Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMERDGLLRVAGDR
HLELTEKGRALAVSVMRKHRLAERLLVDIIGLPLEEVHAEACRWEHVMSEDVERRLVKVL
DNPTTSPFGNPIPGLPDLGFGSDAGPRETDLVRLTELPAGSPVAVVVRQLTEHVQGDIDL
ITRLKDAGVVPNARVTVEADAEDGVTIVMPGHTDVSLPYAMAHAVKVQKV
Download sequence
Identical sequences A0A1W9YHY3 F5YW42
WP_013829383.1.17185 WP_013829383.1.62923 gi|333991093|ref|YP_004523707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]