SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392984324|ref|YP_006482911.1| from Pseudomonas aeruginosa DK2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392984324|ref|YP_006482911.1|
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.71e-61
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 2.09e-44
Family PA2201 C-terminal domain-like 0.0000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392984324|ref|YP_006482911.1|
Sequence length 294
Comment hypothetical protein PADK2_14650 [Pseudomonas aeruginosa DK2]
Sequence
MHAFPLTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKPRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences WP_004343529.1.101739 WP_004343529.1.21469 WP_004343529.1.50989 WP_004343529.1.58228 WP_004343529.1.62410 WP_004343529.1.79986 gi|392984324|ref|YP_006482911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]