SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319776814|ref|YP_004136465.1| from Mycoplasma fermentans M64

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319776814|ref|YP_004136465.1|
Domain Number 1 Region: 108-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-16
Family Extended AAA-ATPase domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319776814|ref|YP_004136465.1|
Sequence length 297
Comment putative primosomal DNA helicase dnai [Mycoplasma fermentans M64]
Sequence
MAAKEEIKNELFFNSKAEFENKALEIMHGHPQLEALIQANNITNEEILENLFTFINIKES
LDNSQIYPWIFSISRKNEKLVFKKIAAKNEYKSVVTRHINLWLTQICEPNPEARLDRIRL
SSAQRKEMFEYINHLKVAIAKKKQKGLKGIYVYGANNTGKTYIASAIANEFAAEGISSVY
LTTSALYSFLISNMGSNATNANAVIDIINKLKKVNALIIDEIGLEKNNYWFRLQVLMEII
ESRIANNKITFFFSGMNKKEFESYYHDQLKREPYKVKTFTSRILNNTLEFCIDEIEK
Download sequence
Identical sequences Q9RFQ3
gi|319776814|ref|YP_004136465.1| WP_013354342.1.1463 WP_013354342.1.78519 WP_013354342.1.95544 gi|308189654|ref|YP_003922585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]