SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328951034|ref|YP_004368369.1| from Marinithermus hydrothermalis DSM 14884

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328951034|ref|YP_004368369.1|
Domain Number 1 Region: 281-451
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.16e-44
Family MgtE membrane domain-like 0.000000444
Further Details:      
 
Domain Number 2 Region: 138-270
Classification Level Classification E-value
Superfamily CBS-domain pair 3.03e-39
Family CBS-domain pair 0.000000747
Further Details:      
 
Domain Number 3 Region: 7-135
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.44e-23
Family MgtE N-terminal domain-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328951034|ref|YP_004368369.1|
Sequence length 452
Comment magnesium transporter [Marinithermus hydrothermalis DSM 14884]
Sequence
MRTLERENLFELLRTALEQGDIPKVRALAQTLHPREILDRWAELPGEYRYVLLTHLPPDH
AAAIFANLEAADQAEFLETLPPWRVQELLEALDPDDLTDALQALQEQNPQLAQELIASLE
PETRAEVEALSEYEEDEAGGLMTPEFIAVRASMTVEEVLRFLRRTAPDAETVYYLYVIDD
ERRLVGVLSLRDLIVADPRTRVQEIMRPDVVHITTDTDQEEVARLMADYDFSVLPVVDDA
GRLVGIVTVDDVLDVLEEEATEDIHRLGAVDAPELVYSRSSVWHLWGARVRWLVVLILTG
MLTSSILAGFERVLQAATALAFYIPVLLGTGGNTGNQSSTLIVRALATRDINLSDWPRIL
LKELGVGALLGLTLSAFIAVKVAVDGFAAITPVVALSLFLLVVVANLAGALLPLVLRSLK
LDPALISNPLIATVSDVSGLLIYLSVARLLLS
Download sequence
Identical sequences F2NPH8
WP_013704306.1.12164 gi|328951034|ref|YP_004368369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]