SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334336735|ref|YP_004541887.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334336735|ref|YP_004541887.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-46
Family Ribonuclease PH domain 1-like 0.000000398
Further Details:      
 
Domain Number 2 Region: 322-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.96e-43
Family Ribonuclease PH domain 1-like 0.000000898
Further Details:      
 
Domain Number 3 Region: 153-261
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.41e-25
Family Ribonuclease PH domain 2-like 0.00000933
Further Details:      
 
Domain Number 4 Region: 475-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.52e-23
Family Ribonuclease PH domain 2-like 0.0000123
Further Details:      
 
Domain Number 5 Region: 577-689
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.32e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 267-346
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.92e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334336735|ref|YP_004541887.1|
Sequence length 750
Comment Polyribonucleotide nucleotidyltransferase [Isoptericola variabilis 225]
Sequence
MEGPEIQFAEAVIDNGRFGTRTVRFETGRLARQAAGSVAAYLDGETMLLSATTAGKHPKE
QFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILACRLIDRPLRPLFVKGLRNEVQ
VVVTVMSIHPDDAYDVLAINAASLSTQISGLPFSGPVAGVRVALIDGQWVAFPKHSDLER
AVFNMVVAGRVVGDDVAIAMIEAEATDDAWKLIKSEGAQAPTEEVVAEGIEAAKPFLRAL
CDAQASLAAQASKEVQEFPLFPDYADDAFAAVESAVSEPLREALAIADKQTRENRLDEIK
AQMLGELQDGFDGREKELSAAYRALQKKLVRRRVLTDGVRIDGRGLADIRTLSAEVEVIP
RVHGSALFERGETQILGVTTLNMLRMEQQIDSLGPVTRKRYMHNYNFPPFSTGETGRVGS
PKRREIGHGALAERALVPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSLLNAGV
PLKAPVAGIAMGLISDTVDGETRYAALTDILGAEDAFGDMDFKVAGTREFVTAIQLDTKL
DGIPASVLASALQQARDARLTILDVIAEAIDTPDEMSPNAPRVITVKVPVDKIGEVIGPK
GKMINQIQEETGAEISIEDDGTVYIGATDGPSAEAARAAINAIANPHVPEVGERFVGTVV
KTTSFGAFVSLSPGKDGLLHISQIRKLVGGKRVENVEDVLSIGQKVQVEIGEIDPRGKLS
LVAVTEDDEAKADEPAGEPGDAAASDRVEA
Download sequence
Identical sequences F6FRZ2
gi|334336735|ref|YP_004541887.1| WP_013838385.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]