SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479182231|ref|YP_007809344.1| from butyrate-producing bacterium SM4/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479182231|ref|YP_007809344.1|
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.31e-44
Family Bacterial dinuclear zinc exopeptidases 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479182231|ref|YP_007809344.1|
Sequence length 239
Comment Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [butyrate-producing bacterium SM4/1]
Sequence
MYREEIEKYIDSHRGEMLEDIKSLCRINSEKMPYQEGMPYGEGACQALGTALAMAEGYGF
SICNYDNYVGTVDWGGEESQLDILAHLDVVPAGEGWTVTEPFEPVEKDGRLYGRGTADDK
GPAVAALYALRAVKELGIPLKKRVRLILGTDEECGSSDIKHYYAVEKEAPMTFSPDGAFP
VVNIEKGHLEGEFEAEFEASQELPRVKSIKAGTKINVVPGKDLEPEHAAQGSVLCVQGI
Download sequence
Identical sequences D4MPK8
gi|479182231|ref|YP_007809344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]