SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479183532|ref|YP_007810645.1| from butyrate-producing bacterium SM4/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183532|ref|YP_007810645.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000000288
Family N-utilization substance G protein NusG, N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479183532|ref|YP_007810645.1|
Sequence length 201
Comment Transcription antiterminator [butyrate-producing bacterium SM4/1]
Sequence
MWYVIQTETGKEEEILLFMRNMIPEELCRHCFLIWAEWPRRAGGQWNIVKKNMFPGYIFA
ETEEPEELFQRLKKVPGLTKLLGGDRCEFIPLGAEEERFFCMIGEKEGNCTGENRAAKGR
AGTNKRKWDCLSVRPSTVRVDEEGKLEILNGALRSFKEEIVRVNLHKRYAVVRVRMLGEK
TVLFGLAMEKDELRQQAGERS
Download sequence
Identical sequences D4MTA9
gi|479183532|ref|YP_007810645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]