SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307151242|ref|YP_003886626.1| from Cyanothece sp. PCC 7822

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307151242|ref|YP_003886626.1|
Domain Number - Region: 13-126
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0565
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307151242|ref|YP_003886626.1|
Sequence length 151
Comment hypothetical protein Cyan7822_1351 [Cyanothece sp. PCC 7822]
Sequence
MTVHLKQEIEKLYEEDYVLWLEQTAEQIRHKDIDNLDWQHLLEEIEDLGKSQKNAVESYL
RQLLKHLLLYQYWTQERDYSGDGWAEEIDNFRNELEILLDSKTLYNYAASILEAIYQKAR
RSAFNKTKLDIFPAECPYTLEQVLDIDYLPE
Download sequence
Identical sequences E0UIP2
gi|307151242|ref|YP_003886626.1| WP_013321458.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]