SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307151833|ref|YP_003887217.1| from Cyanothece sp. PCC 7822

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307151833|ref|YP_003887217.1|
Domain Number - Region: 212-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family FCH domain 0.035
Further Details:      
 
Domain Number - Region: 328-355
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0824
Family Rubredoxin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307151833|ref|YP_003887217.1|
Sequence length 404
Comment IS605 OrfB family transposase [Cyanothece sp. PCC 7822]
Sequence
MTAPKDCEAARAFKFRFYPTKEQENILRRTLGCVRLVYNKALHERTQAWYERLERIDYCQ
TSAMLTSWKKQEDLDFLNEVSCVPLQQTLRHLQRAFANFFGKTAKYPRFKKKRSGGSAEF
TKSAFKWKDGQVWLAKCKEPLTIRWSQQLPQNTEPSTITIKLDASGRWFISLLVRDESIE
PLPKTDKVIGIDLGITSLITTSNGTKVSNPRHFNKLYKKLKRVQKAYSKTQKGSKNREKA
RLKVAKVHAKIGDSRRDFLHKLTTQLVRENQTIVVEDLAVRNMVKNSKLAKAISDCGWSE
FVSQLEYKCQWYGRELVKIDRFFPSSKRCGNCGLVIDKLPLSVRSWECPECGTVHDRDIN
ASRNILAAGLAVRVCGADIRPDRHKSKGQLRKTRIREGNKKPKS
Download sequence
Identical sequences E0UBJ8
gi|307151833|ref|YP_003887217.1| WP_013322048.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]