SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333896463|ref|YP_004470337.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333896463|ref|YP_004470337.1|
Domain Number 1 Region: 334-407,439-830
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.44e-94
Family Amylase, catalytic domain 0.000000929
Further Details:      
 
Domain Number 2 Region: 247-365
Classification Level Classification E-value
Superfamily E set domains 1.76e-26
Family E-set domains of sugar-utilizing enzymes 0.00093
Further Details:      
 
Domain Number 3 Region: 1254-1352
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000916
Family Starch-binding domain 0.012
Further Details:      
 
Domain Number 4 Region: 928-1014
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000623
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 830-922
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000003
Family alpha-Amylases, C-terminal beta-sheet domain 0.022
Further Details:      
 
Domain Number 6 Region: 1170-1245
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000116
Family Fibronectin type III 0.004
Further Details:      
 
Weak hits

Sequence:  gi|333896463|ref|YP_004470337.1|
Domain Number - Region: 155-220
Classification Level Classification E-value
Superfamily E set domains 0.014
Family AMPK-beta glycogen binding domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333896463|ref|YP_004470337.1|
Sequence length 1876
Comment Pullulanase [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MYKKVLSKKFISFVMSLLLVLTAVFSSMPFHNAYAADNASIVANIVGDFQDQLGDSNWNI
DSNITIMQYVGNGLYEFTTPTQLKAGSYQYKVALNHSWAGGGVPSQGNLTLNLTNDSYVT
FWFDYNTQSLTDSTKYTPISNDKLPRLVGTIQSAIGAGNDWDPGTSTAIMIDDNFDNVYS
YTAHVPKGNYEYKVTLGNTWDENYGANGAQDGSNIQLNVISDADITFFYDAKTHNIWTNY
SPTLTGLDNNIYYDDLKHDTHDPFFRNPFGAIKVGQTVTLRIQAKNHDLESARISYWDDI
NKTRTELPMTRIGESPDSNYEYWEIKLSFDHPTRIWYYFILKDGTKTAYYGDNDDQLGGV
GKATDTVNKDFELTVYDKNFDTPDWMKGAVMYQIFPDRFYNGDTSNDHAKTLSRGNDPIE
FHNNWNDLPDNPNNAGKLGYTGDGIWSNDFFGGDLKGIDDKLDYLKGLGVSVIYLNPIFE
SPSNHKYDTADYTKIDEMFGTTQDFEKLMSDAHAKGIQIILDGVFNHTSDDSIYFNRYGK
YPDLGAYQAWKEGNQSLSPYGDWYTINSDGTYECWWGYDSLPVIKSLNGSEYNVTSWANF
IINDKNAISKYWLNPDGNLNDGADGWRLDVETEVAHDFWTHFRDAINTVKPEAPMIAENW
GDASLDLLGDSFNSVMNYQFRNDIIDFLIGQPFDDGNGQHNPIDAAKLDQRLMSIYERYP
LPAFYSTMNLLGSHDTMRILTVFGYNSADPNENSDAAKQIAEQKLKLATILQMGYPGMAD
IYYGDEAGVSGGKDPDDRRTFPWGNEDTALQDFFKNISRIRNNNQVLKTGDLETLYAQND
VYAIGRRIINGKDAFGKSYPDSAAIVAINRSNSDKQITIDTTKFLRDGVTFKDLINNNAS
YSISNGQIVIDVPSMSGVMLISDDGQDLTAPQAPSNVVAISGNGKVDLSWSQSDGATGYN
VYRSSVEGGLYEKIASNVTGTTFEDTNVTNGLKYVYAISSVDELGNESEMSNDAVAYPAY
PIGWVGNLTQVSDNHIIGVDKPTEDIYAEVWADGLTNSAGQGLNMIAQLGYKYVGGTVYD
SVYGSVYNSVYGVDNSDFTWVNAQYVGDIGNNDQYKASFTPDKIGQWEYLMRFSDNQGQS
WLTTNTLSFYVGPSDDLIKPTEPYLNQPGTESSRVSLTWSPSTDNVGIYDYEIYRSEGGT
SFNKIATVSNEVYNYVDTSVINGKTYSYKVVAVDPSFNRTESNVVTIKPDIVPIKVTFNV
TVPDYTPDAVNLAGTFPNATWDPSAQQMTKINDNTYSITLTLDEGTQLEYKYARGSWDKV
EKDEYGNELASNRKVTIVNQGNNEMTINDTVYRWRDIPIFIYSPNSNNVTVDSDTNIIQI
KGNTYEGAKVTINGDSFVQNENGVFTKDVSLNYGANTIKIHVEPNDGSVYGNDQGRIAEL
TKDIEIDVNRQENNSGSSIGNNNTGTSGSNSSSAGNNNTESTSTSTTSTTSVNSSNTNNT
NNTNNTNNTIGAVNKNGNIITLTLDAGKAKDLIINSKDKKVVFDITTIGQGQQKVVQISK
DILDTSAANGKDIVIKSDNASIALTKDALNQNQIQNGVNVSIKDNGKPNVTNYMPLSNVV
DITIGSSSGNVALAKPVEVTLNISKANDPRKVAVYYYNPTTNQWEYVGGKVDVSSGTITF
NATHFSQYAAFEYDKTFNDIKDNWAKDVIEVLASRHIVEGMTDTQYEPNKTVTRAEFTAM
ILRLLNIKEETYNGEFSDVKSGDWYANAIEAAYKAGIIEGDGKNARPNDNITREEMTAIA
MRAYEMLTQYKEENIGATSFSDDKSISDWARNVVANAAKLGIVNGEPNNAFAPKGVATRA
EAAAIIYGLLEKSGNI
Download sequence
Identical sequences F6BHZ6
gi|333896463|ref|YP_004470337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]