SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333896467|ref|YP_004470341.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333896467|ref|YP_004470341.1|
Domain Number 1 Region: 38-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.76e-102
Family Amylase, catalytic domain 0.000000000000291
Further Details:      
 
Domain Number 2 Region: 607-709
Classification Level Classification E-value
Superfamily Starch-binding domain-like 5.64e-34
Family Starch-binding domain 0.00000124
Further Details:      
 
Domain Number 3 Region: 434-521
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.84e-31
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000739
Further Details:      
 
Domain Number 4 Region: 525-601
Classification Level Classification E-value
Superfamily E set domains 7.98e-17
Family E-set domains of sugar-utilizing enzymes 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333896467|ref|YP_004470341.1|
Sequence length 710
Comment cyclomaltodextrin glucanotransferase [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MKKTFKLLLVLVLSLTLVFGLTAPIQAASDTAVSNVVNYSTDVIYQIVTDRFVDGNTSNN
PTGDLYDPTHTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYAVLPDSTFG
GSTSYHGYWARDFKKTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPASETDPTYA
ENGRLYDNGTLLGGYTNDTNGYFHHYGGTDFSSYEDGIYRNLFDLADLNQQNSTIDSYLK
SAIKVWLDMGIDGIRLDAVKHMPFGWQKNFMDSILSYRPVFTFGEWFLGTNEVDANNTYF
ANESGMSLLDFRFSQKVRQVFRDNTDTMYGLDSMIQSTASDYNFINDMVTFIDNHDMDRF
YNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYMTGNGDPYNRAMMTSFNTSTTAYNVIKK
LAPLRKSNPAIAYGTTQQRWINNDVYIYERKFGNNVALVAINRNLSTSYNITGLYTALPA
GTYTDVLGGLLNGNSISVASNGSVTPFTLGAGEVAVWQYVSSSSSPLIGHIGPTMTKAGQ
TITIDGRGFGTTTGQVLFGSTAGTIVSWNDTEVKVKVPSVTPGKYNVSLKTSSGTTSNTY
NNINILTGNQVCVRFVVNNASTVYGENVYLTGNVAELGNWNTSKAIGPMFNQVVYQYPTW
YYDVSVPAGTTIQFKFIKKNGNTITWEGGSNHTYAVPSSGTGTVIVNWQQ
Download sequence
Identical sequences F6BI00
gi|333896467|ref|YP_004470341.1| WP_013787419.1.39170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]