SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333983620|ref|YP_004512830.1| from Methylomonas methanica MC09

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333983620|ref|YP_004512830.1|
Domain Number 1 Region: 55-145
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000471
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333983620|ref|YP_004512830.1|
Sequence length 197
Comment peptidase domain-containing protein [Methylomonas methanica MC09]
Sequence
MKIGNQKFLALAFCLSLLFTNANAAVENLSVDNSSYSNAQYLGNLSAQILMNVFGVRGSV
YSGQINDNDNADFYSFDINAPTTLKLSVFTPAGPIFNNDPVLGLYDANGVQLAFDDDSGA
GWDSFLQYAIGAPGRYIAAVSGYDDTSFAGGGDSNFLYNLQAEIAIVQGNPVPVPGAFWL
MGSSLLGLASFRRKRTL
Download sequence
Identical sequences G0A4B5
WP_013818582.1.77941 gi|333983620|ref|YP_004512830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]