SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317123070|ref|YP_004103073.1| from Thermaerobacter marianensis DSM 12885

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317123070|ref|YP_004103073.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.15e-44
Family Insert subdomain of RNA polymerase alpha subunit 0.0000346
Further Details:      
 
Domain Number 2 Region: 6-50,172-224
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.08e-30
Family RNA polymerase alpha subunit dimerisation domain 0.00052
Further Details:      
 
Domain Number 3 Region: 247-311
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.31e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317123070|ref|YP_004103073.1|
Sequence length 315
Comment DNA-directed RNA polymerase subunit alpha [Thermaerobacter marianensis DSM 12885]
Sequence
MNEMEKPTIETVEISEDGTYGRFVVEPLERGYGITLGNALRRVLLSSLPGAAVTSVRIEG
VLHEFSTIPGVVEDTTEIILNLKELAIKMHTDEPQILRVEAQGEGEVRAADIIAPPEVEI
VNGDHLIATLEHDGRLFMEMTVQRGRGYVPADRNKGPDRSIGLIPVDSIFTPIRKVNFQV
ENTRVGKVTDYDRLTLEIWTNGTVAPDEAASQAARILTDHLALFLTLTDQTRGAGTAAEK
EDDARAKLLEMSIDELDLSVRSYNCLKRAGINTIGELVEKTPEDMMRVRNLGKKSLEEVE
EKLAALGLSLKQPED
Download sequence
Identical sequences E6SKX3
WP_013496646.1.7975 gi|317123070|ref|YP_004103073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]