SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51598666|ref|YP_072854.1| from Borrelia garinii PBi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51598666|ref|YP_072854.1|
Domain Number 1 Region: 67-283
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.06e-55
Family DNA/RNA non-specific endonuclease 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51598666|ref|YP_072854.1|
Sequence length 293
Comment endonuclease precursor [Borrelia garinii PBi]
Sequence
MKKRSKFFLYCYILCLAGFLFFSLNPKVLKQIKHKINDYLEIIENKYIKITKSIPIKESQ
LIPKGYLTTQIISKKHYTLGYAESARQSEWAAYPLKREMVELALTLLKSKKIKRSPKFFE
DTNIKGIFPKLEDYFKSGYDRGHIVSSADMSFSENAMKDTYFLSNMSPQKSEFNSGIWLK
LEKLVREWAILKGYIYIISAGILTENKGFIGKNKILIPKNFYKIVLAINNKNFYDIISFI
IPNEKAKDLNLKNYVVNVDLIEKKTKIDFFAKLDSKIKKNIKKIKTTHSWRFK
Download sequence
Identical sequences Q661K9
WP_011193734.1.42220 gi|51598666|ref|YP_072854.1| 290434.BG0412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]