SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000065 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000000065
Domain Number - Region: 39-156,298-372
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000123
Family Tricorn protease domain 2 0.038
Further Details:      
 
Domain Number - Region: 549-603
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0602
Family Transglutaminase, two C-terminal domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000065   Gene: ENSSTOG00000000078   Transcript: ENSSTOT00000000077
Sequence length 878
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:5194511:5203270:-1 gene:ENSSTOG00000000078 transcript:ENSSTOT00000000077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGTPRVHYLAGFSCPLGGLAAGKPRVLCHEADVFLSTGSEFVYVYDQEGGLLTAVYRF
PDQVWHLQLLAPRRALYVLCARRGIYCLSLDTPSRSVSQANKDSEEDELPYPVMPVDPDA
CVLPDATLCAFIVLDDMLVALAQGPTQWKMQLFEHPCLGEDPQPGGQIGEVELSTYTPEI
GIPGKPTAPHFLPVLCCMSLPGSRAPHGHPQACGGFTLEEALFGLLFGADATLLESPVIL
CGLPDGQLCCVALRALVTSRSAPGDPKALVRILHHLEEPVVFIGALKTEPQTEEAVESEL
SSMEVHSDCLVALGHHGRTLAIKASFDKSGNLVPELQEYFLPGPVLCAACGGGGRIYHST
PSDLRVVDLAQGSIPLDPQQPNRAPGSLPPTLCPTSLSVCSVLTVSVSPRAPAGETELLA
LSAKGRLMSCSLSPKSPGPTRMTSASADRKIKELLSGIGDVSERVSFLKKAVDQRNKALT
SLNEAMNVSCALLSSREGPRPISCTTTTSWSHLPLQDVLTATCLLQNSGDFSLDRGWTLC
IQVLTSSSALDLDAAGSAVTYTIPVDRLGPGSQREVTLPLGPTESGVLDLPVTVSCALFY
SLREVVGGALAPSDPLEDPFLEEHALDLLPEQEGICLPLSRLTVDMLRCLRFPGLASPHT
QAPCLLSPARDPVDTFLEACCGPSSEPTGPASLRAKYLPPSVASIKVSAELLRTALEDAH
SGVPLCSATLQWLLAENAAVDIVKARALSSVQGVAPNGTDIHLIIREVAVTDLCPAGPIQ
AVEIQVESSSLADMCRAHHAIVGRMQAMVREQAAQSSSPPDLRMQYLRQIHANHEALLRE
VQALRDRLCTEDEASSCATAQRLLQVYKQLRSPSLVLL
Download sequence
Identical sequences I3LVX6
XP_021586956.1.77405 ENSSTOP00000000065 ENSSTOP00000000065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]