SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000120 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000120
Domain Number 1 Region: 24-187
Classification Level Classification E-value
Superfamily Lipocalins 6.55e-34
Family Retinol binding protein-like 0.0014
Further Details:      
 
Domain Number 2 Region: 225-282
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00031
Further Details:      
 
Domain Number 3 Region: 285-337
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000120   Gene: ENSSTOG00000000135   Transcript: ENSSTOT00000000135
Sequence length 351
Comment pep:known_by_projection scaffold:spetri2:JH393297.1:3399792:3412088:-1 gene:ENSSTOG00000000135 transcript:ENSSTOT00000000135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLRGSILLLATCVAASADPVPDDIQVQENFDVTRIYGKWFNLAVGSTCPWLKRIKDKM
SVSTLVLGEGATASEISVIHTHWRRGVCEEMSTAYEKTSTAGKFLHRKPKWNMTMESYVV
HTNYDEYAIFLTKKMSRHHGPTITAKLYGRRPQLRDSLLQAFREVALGVGIPEDSIFTMA
DRDLGECVPGEQEPEPTPLSRARRAVLPQEEEGSGAEPPVAGFNRKEDSCQLAHSPGPCL
GLFPRYFYNGSSMACETFQYGGCLGNDNNFVSEKECLQTCRTVAACSLPIVPGPCRAFIE
LWAFDAVQGKCVLFNYGGCQGNGNKFYSEKECKEYCGVPGEGDEELLRYSN
Download sequence
Identical sequences ENSSTOP00000000120 ENSSTOP00000000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]