SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000399 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000399
Domain Number 1 Region: 1015-1344
Classification Level Classification E-value
Superfamily NHL repeat 2.41e-23
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1186-1554
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000000745
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 452-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000599
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000000399
Domain Number - Region: 710-782
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000133
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Domain Number - Region: 518-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 421-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 550-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 386-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00141
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 584-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 356-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1912-2010,2102-2162
Classification Level Classification E-value
Superfamily NHL repeat 0.0628
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000399   Gene: ENSSTOG00000000440   Transcript: ENSSTOT00000000445
Sequence length 2546
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:5710570:6250277:1 gene:ENSSTOG00000000440 transcript:ENSSTOT00000000445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSSPHNQFTFRPLPPPPPPPHACTCARKPPPTADSLQRRSMTTRSQPSPAAPAPPTSTQ
DSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRST
FSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGQLYEN
GISKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWR
FQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLMKQDSKSSDDT
QHSPRNLILTSLQETGFIEYMDQGPWYMAFYNDGKKVEQVFVLTTAIEIMDDCSTNCNGN
GECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDP
TCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSHGICVKGECHCSTGWGGVNCETPL
PICQEQCSGHGTFLLDSGVCNCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGP
TCEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQ
NGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYASPLCQGSPD
PLDLIQQSQPLFSQHTSRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGT
PLVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLSEKRTLWLPWNQFV
VVEKVIMQRVVPDPPSCDISNFVSPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPI
PSSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVY
TFAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVILQGFEMDASNLGGWSLN
KHHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVA
LASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSELLYLSDTNTRK
VYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDKHGFI
YFVDGTMIRRINENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSL
YVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLL
FIAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSS
LAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTLNL
ITRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLK
RVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLE
KLTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEISLS
SEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQSKGNISAFERRLRAHNRNLLSI
DFDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTW
NEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSM
VRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLS
EILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARF
DYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHT
KIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQL
QTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLR
QRGNDIFEYNSNGLLQKAYNKVSGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIR
VTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILY
TPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLL
PKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENLELTYEL
LQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNEGRCLEGGKQPRFAAVP
SVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLG
SLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTV
EEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVL
SVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences ENSSTOP00000000399 ENSSTOP00000000399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]