SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000435 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000435
Domain Number 1 Region: 85-230
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.35e-33
Family AlaX-like 0.012
Further Details:      
 
Domain Number 2 Region: 24-84
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000272
Family AlaX-M N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000435   Gene: ENSSTOG00000000481   Transcript: ENSSTOT00000000483
Sequence length 399
Comment pep:known_by_projection scaffold:spetri2:JH393300.1:17652603:17664359:-1 gene:ENSSTOG00000000481 transcript:ENSSTOT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVTTVVSCQPAELQTDGSNGKKEALSGFHVVLEDTLLFPEGGGQPDDRGTINDISVLRVT
RRGAQADHFTQTPLAPGSQVQVQVDWERRFDHMQQHSGQHLITAVADNLFGLKTTSWELG
RHRSVIELDSPSVTAEQVATIEQCVNEKIRDRLPVSVQELSLDDPEVEKVRGRGLPDDHA
GPIRVVTIEGVDSNMCCGTHVNNLSDLQVIKILGTEKGKKNKTNLIFLAGNRVLKWMERS
HGTEKALTTLLKCGAEDHVEAVKKLQNSSKLLQKNNLNLLRDLAVHIAHCLRNSPDWGGV
VVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPAEAVETLGPRVAEVL
EGKGAGKKGRFQGKATKMNRRAEVQALLQDYVSTQSAEE
Download sequence
Identical sequences ENSSTOP00000000435 ENSSTOP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]