SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000615 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000615
Domain Number 1 Region: 16-127
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-27
Family Netrin-like domain (NTR/C345C module) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000615   Gene: ENSSTOG00000000687   Transcript: ENSSTOT00000000685
Sequence length 163
Comment pep:known_by_projection scaffold:spetri2:JH393319.1:11441806:11470392:-1 gene:ENSSTOG00000000687 transcript:ENSSTOT00000000685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEVKTKCHDVTAVVEVKEV
LKSSLVNIPRDTINLHTSSGCLCPPLTVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRL
GKKVKRWDMKLRHLGLSKSDSSISDSTQNQKSGRNSNPRQARN
Download sequence
Identical sequences ENSSTOP00000000615 ENSSTOP00000000615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]