SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000730 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000730
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.3e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000838
Further Details:      
 
Domain Number 3 Region: 606-713
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.98e-28
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000211
Family TGS domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000730   Gene: ENSSTOG00000000811   Transcript: ENSSTOT00000000816
Sequence length 723
Comment pep:known_by_projection scaffold:spetri2:JH393328.1:7512854:7536970:-1 gene:ENSSTOG00000000811 transcript:ENSSTOT00000000816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMSEEARGPSGKMGSEEKPVDAVEEKRKEGGKKKNKEGSGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVNAESWKTTPYQIACGISQGLADNTVIA
KVNKVVWDLDRPLEGDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLVEFI
RSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMF
DHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYNVFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQQVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTVSETIERLRQLKQSRSKQAE
EEF
Download sequence
Identical sequences ENSSTOP00000000730 ENSSTOP00000000730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]