SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000933 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000933
Domain Number 1 Region: 144-457
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.5e-76
Family Transglutaminase core 0.00000108
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily E set domains 4.9e-39
Family Transglutaminase N-terminal domain 0.00045
Further Details:      
 
Domain Number 3 Region: 473-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.94e-27
Family Transglutaminase, two C-terminal domains 0.0034
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.16e-26
Family Transglutaminase, two C-terminal domains 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000933   Gene: ENSSTOG00000001041   Transcript: ENSSTOT00000001044
Sequence length 691
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:6377775:6393469:-1 gene:ENSSTOG00000001041 transcript:ENSSTOT00000001044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTIALDIESCDFQAAKNNKEHHTSAISSRHLIVRRGQPFTISLHFRTSVHRFLPTLKKVA
LIAQTGQQPSKTNGTQVTLPISTMGDQKWSAAVEERDAHFWAISVTTSADAVIGHYSLLL
QVLGEKEHLLGQFTVLFNPWSREDDVFLPNEAQRSEYVLNQNGLIYLGTADCIQEEPWDF
GQFEKDVMDISLGLLGMDKHMEKWSQPVHVAHVLGTLLQTLKQRSVLPIPQAQTAQEEAL
LNKRRGSVPILRQWITGQGRPVYESQAWVLAAVACTVLRCLGIPARVVTTYASAQGTHGD
LLVDEYYNEEGIQNGEGQRGRIWIFQTSTECWMTRPDFRYPHYAGWQILYPYVPNKGEGL
GSCDLVPVKAVKDGILELTPAVSDLFAAVNASCVVWKCCEDGKLELTNSNTKYVGNNIST
KVVGSDRCEDITQNYKYPAGSLQEKEVMERVQEKRMKQWKPNGIRPPSDKWADPLYLFLE
APSSFPLRGDAQLSVILFNPSDQEKEVQLVIGVQAVYYNGVFAAKLWRKKQFLTLSANLD
MRITISLSFSHFERNPPENSFLRLTVMATHSESGLSCFAQEDVAICRPHLVIQMPETAKQ
YQPLTASISIHNSLDSPMMDCMISIFGRGLIHKERRYGLGSVWPGNTLSTQFKFTPTQLG
LQRLTVEMDCNMFQNLISHRSITVVAPELSA
Download sequence
Identical sequences ENSSTOP00000000933 ENSSTOP00000000933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]