SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000940 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000940
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.34e-69
Family Transglutaminase core 0.00000159
Further Details:      
 
Domain Number 2 Region: 331-429
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.84e-28
Family Transglutaminase, two C-terminal domains 0.0003
Further Details:      
 
Domain Number 3 Region: 218-329
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-27
Family Transglutaminase, two C-terminal domains 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000940   Gene: ENSSTOG00000001050   Transcript: ENSSTOT00000001053
Sequence length 432
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:6406711:6419524:-1 gene:ENSSTOG00000001050 transcript:ENSSTOT00000001053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMRCLGIPTRVVTNFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARK
DLPPGYGGWQVLDATPQETSNGLYCCGPASVRAIKEGEVDLNYDTPFAFSMVNADCTSWL
VSGGKEQKIHQDTNSVGNFISTKSIQSDERDDITENYKYGEGSPQERQVFLKALQKLKNG
RFQGPHRTDSEPSRPMPPNQDSPHSPDTPFLRPSDVVQVSLKFKLLDSPNMGQDINFVLL
ALNMSSQFKDLKLNLSAQSLLHDGSPLSPFWQDMAFITLSPKEAKSYPCKILYSQYSQYL
STDKLIRLSALGEEKSSPEKILANKIITLTYPGIMINVLGEAIMNQPLTIQVIFSNPLSE
QVEDCVLTLEGSGLFKKQQRVLIGVLKPRYKVTVSLKTVPFKSGQRQIQANLRSNKFKDI
KGYRNVYVDFGL
Download sequence
Identical sequences ENSSTOP00000000940 ENSSTOP00000000940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]