SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000950 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000950
Domain Number 1 Region: 53-370
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.03e-121
Family Transglutaminase core 0.00000000848
Further Details:      
 
Domain Number 2 Region: 513-610
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.31e-24
Family Transglutaminase, two C-terminal domains 0.00085
Further Details:      
 
Domain Number 3 Region: 391-510
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-24
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily E set domains 0.000000000042
Family Transglutaminase N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000950   Gene: ENSSTOG00000001064   Transcript: ENSSTOT00000001065
Sequence length 615
Comment pep:known_by_projection scaffold:spetri2:JH393281.1:6448160:6460351:-1 gene:ENSSTOG00000001064 transcript:ENSSTOT00000001065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDSNSLQVSLFTPANAVIGHYTLKIKISRDQGQSVTYPLGNFILLFNPWSAEDDVYLPSE
ILLQEYIMKDYGFVYKGRESFVTSWPWNYGQFEEDIIDICFEILNKSLYFLKNPSKDYSQ
RNDVVYVCRVMSAMINSNDDSGVLQGNWGEDYSKGVSPLEWNGSVAILRQWSARGGQPVK
YGQCWVFASVMCTVMRCLGVPTRVVSNFHSAHNMDGNLTIDTYYDQNAEMLPSEKQDKIW
NFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVRAIKEGEVHLAYDTPF
VYAEVNADEVIWLLRDGKAQEILAHNTSSIGKEISTKMVGSDQRQDITGSYKYPEGSPEE
RSVFMKASRKMLRPKRASSLLLDLLGSRVFEDQPVQLQLHLARMPVWGQDVPLTLHVWRV
PERAHPRGPIRLVVRFCAQPLLHGGGTRKPLWRQMVHLSLDIGKEIQWPLLLPYNNYRNK
LTDEKLIRVSGIAEVEETGRSMLVLKDLSLEPPLLSIEVSERAEVGNILRVHITLTNTLM
VALNNCTMVLEGSGLINGQIVKDLGTLMAGHTIRIQVDFYPIKTGPRQLQVLISSNEVKE
IKGYKDIFVAAATAS
Download sequence
Identical sequences ENSSTOP00000000950 ENSSTOP00000000950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]