SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001013 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000001013
Domain Number - Region: 23-71
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001013   Gene: ENSSTOG00000001126   Transcript: ENSSTOT00000001133
Sequence length 189
Comment pep:known_by_projection scaffold:spetri2:JH393607.1:779853:866459:1 gene:ENSSTOG00000001126 transcript:ENSSTOT00000001133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLLVKPAILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMDLEQELENVKALKTKL
ERRKKASAWERNLVYPAVMILLLIETAISVLLVACNILCLLVDETAMPKGARGPGIGNAS
LSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPRKDDTTMTKIIGNCVSILVLSS
ALPVMSRTL
Download sequence
Identical sequences ENSSTOP00000001013 ENSSTOP00000001013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]