SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001140 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001140
Domain Number 1 Region: 78-193
Classification Level Classification E-value
Superfamily Fibronectin type III 4.68e-31
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 2 Region: 2-101
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-22
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001140   Gene: ENSSTOG00000001273   Transcript: ENSSTOT00000001271
Sequence length 344
Comment pep:novel scaffold:spetri2:JH393310.1:9033546:9057460:-1 gene:ENSSTOG00000001273 transcript:ENSSTOT00000001271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPPPENVRMNSVNFKNILQWTSPVFHKGNLTFTTQYQSYRKFQDKCKNITSTQCDFSNL
SKYGDHILRVRSEFADEYSDWVNISFCPVDDTIIGPPAVQVEALADSLHMQFLAPQIENE
PETWTMKNIYSSWTYNVHYWKNGTDKKFQTTLQYDFGVLRNLEPWTTYCIQVQAFLLVRN
KTGEWSEPVCEQTMEAETTLSWVVAVVLIASVFVVFLMFLGCSVSLWYIYKKTKYTFSPG
NSLPQHLKEFLGNPHHSKLLFFSFPLSDENEVFDKLSVISEDCESSKQNPGDSCSFGTPS
GPGPPELISKGETHFQGGDPYGDSPLLSSASEGDQSDCLRKPQI
Download sequence
Identical sequences ENSSTOP00000001140 ENSSTOP00000001140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]