SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001217 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001217
Domain Number 1 Region: 63-182,258-305
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-48
Family FabD-like 0.00019
Further Details:      
 
Domain Number 2 Region: 191-265
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000811
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001217   Gene: ENSSTOG00000001359   Transcript: ENSSTOT00000001357
Sequence length 307
Comment pep:known_by_projection scaffold:spetri2:JH393528.1:970271:978807:-1 gene:ENSSTOG00000001359 transcript:ENSSTOT00000001357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARVARAAWAWGCSVCCRRGVSNFPIPPPSAVDVAELLRGATTAEEQPSAAAARRAPGQ
CSVLLFPGQGSQVVGMGRGLLGYPRVRELYDAAQRVLGYDLLELSLHGPQEDLDRTVHCQ
PAVFVASLAAVEKLHHLQPAVIENCIAAAGFSVGEFAALVFAGAMEFSEGLYAVKVRAEA
MQEASEAVPSGMLSVLGQPRSKFNFACLEAQKHCKSLGIESPVCEVASYLFPDCRVISGH
LEALRFLQKNSSRYHFRRTKMLPVSGGFHTRLMEPAVQPLAQVLKTVAIRKPLVAVYSNV
SGSRYLH
Download sequence
Identical sequences ENSSTOP00000001217 ENSSTOP00000001217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]