SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001399 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000001399
Domain Number - Region: 148-224
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0983
Family Coronavirus S2 glycoprotein 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001399   Gene: ENSSTOG00000001562   Transcript: ENSSTOT00000001562
Sequence length 377
Comment pep:known_by_projection scaffold:spetri2:JH393433.1:4313420:4506884:1 gene:ENSSTOG00000001562 transcript:ENSSTOT00000001562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSEQAEQPSQPSSTPGGENVVPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTD
EEIDLAFQQSGTAVDEPSSLGPATQVVPVQPPHLISQPYSPVGSRWRDYGALAIIMAGIA
FGFHQLYKKYLLPLILGGREDRKQLERMAASLSELSGSVAQTVTQVQTTLASVQELLRQQ
QQKVQELAHELATAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPS
WQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSPSPGKESHSPEGSTATYHLLGPPEEGE
GVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDVLGVQREDRRGGDGQINEQ
VEKLRRPEGASNENERD
Download sequence
Identical sequences I3LYT5
XP_005334831.1.77405 ENSSTOP00000001399 ENSSTOP00000001399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]