SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001469 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001469
Domain Number 1 Region: 381-673,776-818
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.51e-73
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 654-766
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.13e-23
Family L-aminoacid/polyamine oxidase 0.00042
Further Details:      
 
Domain Number 3 Region: 271-377
Classification Level Classification E-value
Superfamily Homeodomain-like 3.4e-20
Family SWIRM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001469
Domain Number - Region: 60-104
Classification Level Classification E-value
Superfamily RING/U-box 0.023
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001469   Gene: ENSSTOG00000001633   Transcript: ENSSTOT00000001639
Sequence length 819
Comment pep:known_by_projection scaffold:spetri2:JH393362.1:3921136:3962648:1 gene:ENSSTOG00000001633 transcript:ENSSTOT00000001639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRGRSKKRTAYDGSDSLPLRSSGRQAKKKATETADEDEDGVSEKKYRKCEKAGCTAT
CPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTSWKKIWTSNG
KTEPSPKAFMADQQLPYWVQCTKPECGKWRQLTKEIQLTPQVAKTYRCGMKPNIAVKPET
SDHCSLPEDLRVSEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAA
TAGDTSPGKLEASKVAPSALVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYS
RDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGL
INTGVLTVAADQYLLPKDYHNKSVAIVGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRV
WDDKSFKGVTVGRGPQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDK
RMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIDEIYKAFVKESGIQFSELEGQVLQFHLG
NLEYACGSTLHQVSARSWDHNEFFAQFAGDHTLLSPGYSAIIDKLAEGLDIRLNSPVQSI
DYTGDDVQIRTTDGTGFSAQKVLVTVPLAILQKGAIQFNPPLSEKKMKAINSLGAGIIEK
IALQFPYRFWDSKVQGADFFGHVPPSASQRGLFAVYYDMDPQQSVLMSVIAGEAVASVRT
LDDKQVLQQCMATLRELFKEQEVPEPTKYFVTRWSTEPWIQMAYSFVKTFGSGEAYDIIA
EDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences I3LYZ0
ENSSTOP00000001469 ENSSTOP00000001469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]