SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001657 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001657
Domain Number 1 Region: 445-468
Classification Level Classification E-value
Superfamily Notch domain 0.0000889
Family Notch domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000001657
Domain Number - Region: 956-1028
Classification Level Classification E-value
Superfamily EF-hand 0.00282
Family Parvalbumin 0.059
Further Details:      
 
Domain Number - Region: 508-535
Classification Level Classification E-value
Superfamily Notch domain 0.00484
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001657   Gene: ENSSTOG00000001855   Transcript: ENSSTOT00000001857
Sequence length 1238
Comment pep:known_by_projection scaffold:spetri2:JH393302.1:12233912:12308690:1 gene:ENSSTOG00000001855 transcript:ENSSTOT00000001857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQKRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKQLECLLTHCIKVPMLILDPPLPANSTLKDLPSLYPSFHSASDIFNIAKPKNPSTNV
SVVVFESTKDVEDAHAGVFKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
SQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKGFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVKIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCTGNNGGSRFVAG
GGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYIIPKGECLPYFSFAEIAKRGVEGAYSDNPIIRHASIANKWKTIHL
IMHGGMNATTIHFNITFQNTNDEEFKIQLTVDVDTREGPKVNATTQKSYENLDSPITLLP
EAEILFEDIPEEKRFPKVKRHDVNTTGRFQEEVKVPLVNISLLPKEAQLSLSNLDLQLEQ
GDITLKGYNLSKIALLRSFLVNLQDDKVKNQATITDEINDSLEVPTEKLAHESLGRLHRS
TFPSGTVKMNYQGQNPPLLLETKARFKLETQTPNGNVSKGKLSSLIIPLKIHEITGKEEE
QNRMEEDAKDHLDVNEVLPGRKLQHFIGTHLGFLPWEKKKYFQDLLDEEESLKTQLAYFT
DSKHTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFD
KTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIRTLATRIH
DLPLSLQDLTGLEHMLINCSKTLPANVTQLNHIAPTQEAYYDPNLPPVTKNLVTNCKPVT
DKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNH
KDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLAT
LIIFTVFSFFAEQLIALKRKVFPRRRINKEASPDRIRV
Download sequence
Identical sequences ENSSTOP00000001657 ENSSTOP00000001657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]