SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001683 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001683
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily PWI domain 0.00000527
Family PWI domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001683   Gene: ENSSTOG00000001889   Transcript: ENSSTOT00000001888
Sequence length 683
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:607122:632598:1 gene:ENSSTOG00000001889 transcript:ENSSTOT00000001888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTL
RFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVE
EEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPER
LPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEK
PSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAAR
KTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEH
PAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQG
VHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLH
RIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREH
FKKHGAEHYWDLALSESVLESTD
Download sequence
Identical sequences A0A287AP63 A0A2J8VEQ4 A0A2K5D6K4 A0A2K5QN02 A0A2K5WYM8 A0A2K6D112 A0A2K6NT02 E2R4I0 F2Z4C4 F7DLG7 G1T1X4 G2HGL9 G3H2W0 H9G1P1 I3LZD9 L8IN18 M3WJS5 O43395 U3DW67 W5QI06
ENSSTOP00000001683 ENSOCUP00000010111 ENSECAP00000017706 ENSOARP00000022356 ENSSSCP00000024319 gi|4758556|ref|NP_004689.1| 9598.ENSPTRP00000002125 9606.ENSP00000315379 9615.ENSCAFP00000017399 9796.ENSECAP00000017706 9913.ENSBTAP00000018533 9986.ENSOCUP00000010111 ENSOCUP00000010111 3jcr_K 5o9z_E ENSP00000315379 ENSECAP00000017706 ENSCAFP00000017399 ENSFCAP00000012927 ENSPTRP00000002125 ENSBTAP00000018533 ENSP00000315379 ENSP00000463374 NP_001126781.1.23681 NP_001233355.1.37143 NP_004689.1.87134 NP_004689.1.92137 XP_002715642.1.1745 XP_002759914.1.60252 XP_003365085.1.31192 XP_003498689.1.69978 XP_003639679.1.84170 XP_003990619.1.62641 XP_004002498.1.66739 XP_004404258.1.74151 XP_005203927.1.76553 XP_005331214.1.77405 XP_005542055.1.63531 XP_005542056.1.63531 XP_005610226.1.31192 XP_005610227.1.31192 XP_005677730.1.57651 XP_005677731.1.57651 XP_005894956.1.15283 XP_005970778.1.78601 XP_005970779.1.78601 XP_006049295.1.26621 XP_006049296.1.26621 XP_006049297.1.26621 XP_006186659.1.101512 XP_006728384.1.47382 XP_006728385.1.47382 XP_006935144.1.62641 XP_006982619.1.50099 XP_006982620.1.50099 XP_007088119.1.5354 XP_007109765.1.24612 XP_007178046.1.59432 XP_007463565.1.90284 XP_007624081.1.28591 XP_008513132.1.77740 XP_008513134.1.77740 XP_008513135.1.77740 XP_008693936.1.72690 XP_008693937.1.72690 XP_008693938.1.72690 XP_008841973.1.79516 XP_008841974.1.79516 XP_010385569.1.97406 XP_010837013.1.44457 XP_011767492.1.29376 XP_011767493.1.29376 XP_012016795.1.54773 XP_012016796.1.54773 XP_012016797.1.54773 XP_012035883.1.66739 XP_012035892.1.66739 XP_012318008.1.9421 XP_012318009.1.9421 XP_012419163.1.74151 XP_013216665.1.77405 XP_013817898.1.57651 XP_014720879.1.49734 XP_014720880.1.49734 XP_014720881.1.49734 XP_014940332.1.86478 XP_014940333.1.86478 XP_014940334.1.86478 XP_015007022.1.72884 XP_015007031.1.72884 XP_015358500.1.40921 XP_015358501.1.40921 XP_016827368.1.69978 XP_017401866.1.71028 XP_019288530.1.44245 XP_019288531.1.44245 XP_019288532.1.44245 XP_019693335.1.62641 XP_019811950.1.53367 XP_019811973.1.53367 ENSCAFP00000017399 ENSP00000315379 ENSP00000463536 GO.35478 ENSPTRP00000002125 ENSSSCP00000024319 ENSSTOP00000001683 ENSBTAP00000018533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]