SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001688 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001688
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 206-302
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.29e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000639
Further Details:      
 
Domain Number 3 Region: 381-492
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 8.5e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001688   Gene: ENSSTOG00000001892   Transcript: ENSSTOT00000001894
Sequence length 504
Comment pep:known_by_projection scaffold:spetri2:JH393415.1:1743117:1814084:1 gene:ENSSTOG00000001892 transcript:ENSSTOT00000001894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQPPPPRKVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKC
SGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNF
ANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYSTQVNN
ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDLCGI
SEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPP
PPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRVYPPPPPALPSSAPSGPPPP
PPPLSVVGSVTAPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGNKAALLDQIREGAQLKK
VEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESAPPTPAPTSGIVGALMEVMQKRSKA
IHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences I3LZE3
ENSSTOP00000001688 XP_005333991.1.77405 ENSSTOP00000001688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]