SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000001736 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000001736
Domain Number 1 Region: 311-724
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.84e-112
Family Phosphofructokinase 0.00000707
Further Details:      
 
Domain Number 2 Region: 1-309
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.88e-97
Family Phosphofructokinase 0.00000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000001736   Gene: ENSSTOG00000001938   Transcript: ENSSTOT00000001947
Sequence length 751
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:6006246:6031590:1 gene:ENSSTOG00000001938 transcript:ENSSTOT00000001947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATWESVSMMLQLGGTVIGSARC
KDFRDREGRLRAALNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITPEE
ATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMG
RHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDK
NGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTP
DTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLA
HVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIALIQGNRVLVVHDGFEGLAKGQIE
EAGWSYVGGWTGQGGSKLGTKRTLPKKNFEQISANITKFNIQGLVIIGGFEAYTGGLELM
EGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFI
IETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNE
KCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSG
KIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTELKDQTDFEHRIPKEQWWLKLRPIL
KILAKYEIDLDTSDHAHLEHISRKRSGEAAV
Download sequence
Identical sequences ENSSTOP00000001736 ENSSTOP00000001736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]