SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002068 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002068
Domain Number 1 Region: 172-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000916
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 33-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000706
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002068   Gene: ENSSTOG00000002313   Transcript: ENSSTOT00000002313
Sequence length 267
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:7399717:7406908:1 gene:ENSSTOG00000002313 transcript:ENSSTOT00000002313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCGLLLPRRLLLLGMAALAASAPETADLVDLCGQAWRGDALLLRSHSASRKFYFVAPH
TDCVLWMHATAAGDRIRFQFHFFLVYSLTSGAQEPNVSSLAPADPCAPGSYLQFYEGPPG
APRPLGPPLCGLTISAPVASSGSSLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRCQN
GRCIPQSLVCDPWGMDNCGDGSDQGSWPPASCRGPSAVPRWTRSTHDNASEPLALGSADP
LQVTAQTSPPGSGDPAQEDAVLEGRQT
Download sequence
Identical sequences ENSSTOP00000002068 ENSSTOP00000002068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]