SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002090 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002090
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-38
Family Frizzled cysteine-rich domain 0.0000573
Further Details:      
 
Domain Number 2 Region: 170-282
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000283
Family Netrin-like domain (NTR/C345C module) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002090   Gene: ENSSTOG00000002344   Transcript: ENSSTOT00000002338
Sequence length 295
Comment pep:known_by_projection scaffold:spetri2:JH393386.1:605022:612297:-1 gene:ENSSTOG00000002344 transcript:ENSSTOT00000002338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQGPGSLLLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKSKSE
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences I3M081
ENSSTOP00000002090 ENSSTOP00000002090 XP_005330961.1.77405 XP_015339978.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]