SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002105 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002105
Domain Number 1 Region: 255-564
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-117
Family Transglutaminase core 0.0000000174
Further Details:      
 
Domain Number 2 Region: 103-250
Classification Level Classification E-value
Superfamily E set domains 2.2e-45
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 578-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-30
Family Transglutaminase, two C-terminal domains 0.00049
Further Details:      
 
Domain Number 4 Region: 690-789
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-29
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002105   Gene: ENSSTOG00000002351   Transcript: ENSSTOT00000002354
Sequence length 817
Comment pep:known_by_projection scaffold:spetri2:JH393532.1:292988:306480:1 gene:ENSSTOG00000002351 transcript:ENSSTOT00000002354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRSRGGRARSFWARCCGCCSRRNRADD
DWGPEPSGSRSRGSGSRSRGSSSRDRRPDSRSSGINAAGDGTIREGMLVVTGVDLLSSRS
DQNRREHHTDEYEYDELIVRRGQPFHVVLFLNRSYESSDRIALELLIGNNPEVGKGTHVI
IPVGKGGSGGWKAQVMKASGQNLNLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPFDPHNE
IYILFNPWCPGNTEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLD
ACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSV
EILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDE
NMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVES
IKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMRED
ITHIYKHPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLTVSVV
LTNRGSSRRTVKLHLYLSVTYYTGVTGSTFKESKKEVALAPGASERVTMPVAYKEYRPHL
VDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPV
TLTNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVH
GVIQVDVAPASGGMNFSDAGGDSRSGETIPMASRGGA
Download sequence
Identical sequences ENSSTOP00000002105 ENSSTOP00000002105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]