SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002308 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002308
Domain Number 1 Region: 4-553
Classification Level Classification E-value
Superfamily SIS domain 1.51e-232
Family Phosphoglucose isomerase, PGI 0.00000000000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002308   Gene: ENSSTOG00000002576   Transcript: ENSSTOT00000002580
Sequence length 558
Comment pep:known_by_projection scaffold:spetri2:JH393380.1:1582389:1608437:-1 gene:ENSSTOG00000002576 transcript:ENSSTOT00000002580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRNPQFQKLQQWHQDNSSDLNLRRLFDADKERFNHFSLTLNTNHGHILVDYSKNLV
TEEVMHMLVDLAKSRGVEAARESMFKGEKINSTEDRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLEKMKSFCQRVRSGNWKGYTGKSITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWFVSNIDGTHIAKTLANLNPESSLFIIASKTFTTQETITNAETAKEWFLASAKDTSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFENFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHALLPYDQYLHRFAAYFQQGDMESN
GKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTDEARKELQAAGKSAEDIEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELEGSAEVTSHDS
STNGLISFIKHQRDAKTE
Download sequence
Identical sequences I3M0P6
ENSSTOP00000002308 ENSSTOP00000002308 XP_005330677.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]