SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002334 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000002334
Domain Number - Region: 118-165
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0628
Family Anti-sigma factor antagonist SpoIIaa 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002334   Gene: ENSSTOG00000002596   Transcript: ENSSTOT00000002609
Sequence length 674
Comment pep:known_by_projection scaffold:spetri2:JH393332.1:7303635:7353448:1 gene:ENSSTOG00000002596 transcript:ENSSTOT00000002609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATATSGPCAGGSRDILWRXLGWRIVASVVWSVLLLPICATVFIVFSSIDLFHPIQWLSD
SFNDLYSSYVIFYLLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIFHPQQLMHSFV
HAALGMVMAWCAAMITKGRYSFLVVPCSDTESLDSSAARNCLNEYHLFFLLAGAFMGYSY
SLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLIKHSCVESLFLVRNFCIVYYFLGHIPKA
WISTAMDLLIDEQFHRPLDTISGLLSLPLLYHIWLCGVFLLTTWYISWILFKIYATEAHV
FPVQLPFAEESDECLPKVLNSNPPLIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPH
NWAAISRECLNLLNDMTQKLVLYQEAAATNGRVSSSYPLEPKKLNSPGNFEYPTPKSSQM
PRSSVPPLVKTSLFSSKLPTPDVSSPFGSPFGSSMMNRMAGIFDVNTCYGSPQSTQLIRR
GPRLWTSASGKEFSNPSMENMGTSMSAEGKTVRQPNVIYSWIQNKREQIKNFLSRRVLIM
YFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQE
AVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASA
EHQKRLQQFLEFKE
Download sequence
Identical sequences ENSSTOP00000002334 ENSSTOP00000002334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]