SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002976 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002976
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.09e-116
Family Transglutaminase core 0.0000000000192
Further Details:      
 
Domain Number 2 Region: 8-191
Classification Level Classification E-value
Superfamily E set domains 1.71e-55
Family Transglutaminase N-terminal domain 0.0000000141
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.96e-31
Family Transglutaminase, two C-terminal domains 0.00000259
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.1e-28
Family Transglutaminase, two C-terminal domains 0.00000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002976   Gene: ENSSTOG00000003326   Transcript: ENSSTOT00000003327
Sequence length 732
Comment pep:known_by_projection scaffold:spetri2:JH393344.1:6201362:6358801:1 gene:ENSSTOG00000003326 transcript:ENSSTOT00000003327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTSRTTFGGRRAIPPNNSNAAEDDLPTEELQGLVPRGVNLQEFLNVTAVHLFKERWDS
NKIDHHTDKYDNDKLIVRRGQSFYVQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PVVPELQKGKWGAKVIMNEDRSVRLSIQSSPECIVGKFRMYVAIWTPYGILRTRRNPETD
TYILFNPWCEEDAVYLDNEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDRAQMDLSGRGNPIKVSRVGSAMINAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSESPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGS
VSNKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVETLDTTHIGKLIVTKQLEGDGIQDITD
TYKFQEGQEEERLALETALMYGAKKALNTEGVVKSRSDVDMDFEVENAVLGKDFKITITF
RNSSSSRYSISAYLSGNITFYTGVSKTEFKKETFDVVLEPLSFKKEEVLVRAREYMSQLL
EQGFLHFFVTARINETKDVLAKQKSTVLTIPKVIIKVRGAAVVGSDMVVTVEFTNPLKET
LQNVWMYLEGPGVIRPKRKTFREIRPNATVQWEEVCQPWVPGRRKLIASLTSDSLRHVYG
ELDLQIQRRPSV
Download sequence
Identical sequences I3M231
ENSSTOP00000002976 XP_005327548.1.77405 ENSSTOP00000002976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]