SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003054 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003054
Domain Number 1 Region: 1780-2025
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.81e-54
Family Ankyrin repeat 0.0000000653
Further Details:      
 
Domain Number 2 Region: 799-929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 3 Region: 470-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000118
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 4 Region: 1055-1165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 571-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000589
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 387-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 508-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000324
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 183-318
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 157-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000154
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 10 Region: 1175-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000166
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 929-1041
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 12 Region: 1468-1501
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 13 Region: 1249-1299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1339-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.019
Further Details:      
 
Domain Number 15 Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.038
Further Details:      
 
Domain Number 16 Region: 310-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 352-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.017
Further Details:      
 
Domain Number 18 Region: 120-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 736-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1387-1419
Classification Level Classification E-value
Superfamily Notch domain 0.000000745
Family Notch domain 0.0012
Further Details:      
 
Domain Number 21 Region: 1427-1459
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 22 Region: 775-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 692-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000578
Family EGF-type module 0.01
Further Details:      
 
Domain Number 24 Region: 79-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000003054
Domain Number - Region: 1206-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000339
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1292-1326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003054   Gene: ENSSTOG00000003378   Transcript: ENSSTOT00000003412
Sequence length 2323
Comment pep:known_by_projection scaffold:spetri2:JH393406.1:5265689:5300429:1 gene:ENSSTOG00000003378 transcript:ENSSTOT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPRLCGGRLDRDPISLSKKTPVRALPLLLLLAGPGAAAPPCLDRSPCANGGRCTQLPSR
EAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPD
PCLSSPCAHGARCSVGSDGRFICSCPPGYQGRSCRSDIDECRVGGPCRHGGTCLNTPGSF
HCQCPNGYTGPLCENPTVPCAPSPCRNGGTCRQNGDLTYDCACLPGFEGQNCEVNVDDCP
GHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCV
CVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCH
EDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR
GYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAAPGFTGTYCEVDIDECQSSPCV
NGGVCKDRVNGFSCACPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCEHNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASNPCGEGGSCVDGENGFSCLCPPGSLPPLCLPPTHPCAHEPCSHGICHDAPGGFRCV
CEPGWSGPRCSQSLARDACESQPCGAGGTCISDGMGFHCTCPPGVQGRQCELLSPCTPNP
CEHGGRCESAPGQLTVCSCPPGWQGPRCQQDVDECAGPSPCGAHGSCTNLAGSFSCTCHG
GYTGPSCDQDINDCDPNPCLNGGSCQDSVGSFSCSCLPGFAGPRCAHDVDECLSNPCGPG
TCTDHVASFTCTCPPGYGGFHCEKDLPNCSPSSCFNGGTCVDGVNSFSCLCRPGYLGAHC
QYEADPCLSRPCLHGGVCSATHPGFHCACREGFTGSQCQTLVDWCSHEPCQNGGRCVQNG
AYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDQDSSHYCVCPEGRTGS
YCEHEVDPCLAQPCQHGGTCRGYMGGYMCECPAGYSGDNCEDDVDECASQPCQHGGSCID
LVDRYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLNNGTCVDLVGGFHCNCPPGYTG
LHCEADINECRPGACHAAHTRDCLQDPGGHFRCLCHAGFTGPRCQTVLAPCESQPCQHGG
QCRPSPGPGGGLTFTCHCVQPFWGPRCEQVARSCRELQCPVGVPCQQTARGPRCACPPGL
SGPSCRGSRGSSQGAANATCAALPCLHGGSCRAAPLAPFFRCLCVPGWDGPRCETPAAAP
EITEEPRCPRAACQAKRGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNN
SRCDPACSSPACLYDNFDCHTGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYH
RPSPGSELRTRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVER
LDFPYPLRDVRGEPMELPEPSVPLLPLLAAGAVFLLVILVLGVMVARRKREHSTLWFPEG
FALHKDVAAGHKGRREPVGQDALGMKNMAKSESLMGEVATDWMDTECPEAKRLKVEEPGM
GAEEPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFC
GGALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGL
GPLLCPPGAFLPGLKAAQSGAKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLAESSVTL
SPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGTGRAGPLGRQPPGGCVL
SLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQMLNPGTPVSPQERPPPYLAAPGHG
EEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATASG
ATATAAGTLPAQPHPLTVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences ENSSTOP00000003054 ENSSTOP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]