SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003111 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003111
Domain Number 1 Region: 576-863
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.43e-97
Family Complement components 0.000000000579
Further Details:      
 
Domain Number 2 Region: 1090-1238
Classification Level Classification E-value
Superfamily TIMP-like 1.29e-47
Family Netrin-like domain (NTR/C345C module) 0.001
Further Details:      
 
Domain Number 3 Region: 936-1091
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.44e-40
Family Alpha-macroglobulin receptor domain 0.00046
Further Details:      
 
Domain Number 4 Region: 252-322
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 7.85e-23
Family Anaphylotoxins (complement system) 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000003111
Domain Number - Region: 401-452
Classification Level Classification E-value
Superfamily E set domains 0.00378
Family SVA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003111   Gene: ENSSTOG00000003426   Transcript: ENSSTOT00000003476
Sequence length 1240
Comment pep:known_by_projection scaffold:spetri2:JH393398.1:3985777:4009878:-1 gene:ENSSTOG00000003426 transcript:ENSSTOT00000003476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTSKQGIPQARQAVRTMQAQPYSTLFNSNNYLHLSVSRMELKPGETLNVNFHLRVDPGQ
DAKIRYYTYLILNKGKLLKAGRQAREPGQDLVVLPLTITADFIPSFRLVAYYTLMGASGK
REVVADSVWVDVKDSCVGTLVVKGGGKDDRQPLPGQQMTLKIEGDRGARVGLVAVDKGVF
VLNKKNKLTQSKIWDVVEKADIGCTPGSGQDYAGVFMDAGLAFKTNKDLGDPRAHKLECS
KPAARRRRSVQLMEKRMDKAGQYKTKELRRCCEDGMRENPMGFPCQRRARFISLGASCVQ
AFLDCCSYITQLRQQHRREGLLGLARSDMDEDIIPEEDIISRSQFPESWLWAIEELKEPE
KNGISTKVLNIFLKDTITTWEILAVSLSDKKGICVADPYEVTVMQDFFIDLRLPYSVVRN
EQVEIRAVLFNYREKESLKVRVELIHNPAFCSLATAKKRYYQTVTIPPKSSVPVPYVIVP
LTIGLQEVEVKAAVYNHFISDGVKKTLKVVPEGIRVNKTVAIRTLDPEHLGQAGVQREEV
PAADLSDQVPDTDSETRILLQGTPVAQMAEDAVDAERLKHLIVTPSGCGEQNMIGMTPTV
IAVHYLDQTEQWEKFGLEKRQNALELIKKGYTQQLAYRQPNSAYAAFTSRAPSTWLTAYV
VKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGLFQEDGPVIAQQMTGGYQNSVEGDVA
LTAFVLIALQEAKDICEGQVNLLGDSISKAGHFLESRYRNLQRPYTVAIAGYALAQMGRL
KGPLFEKFLNSSTDKNRWEESDKHLYNVEATSYALLALLLLRDFDTVPPVVRWLNEQRYY
GGGYGSTQATFMVFQALAQYQTDVPDHKDLNMEVALHLPSRSSQIKHRLLWESGSLLRSE
ETKQNEGFSLTAKGKGQGTLSVVTVYHAKVKGKVKCKNFDLRVTIKPAPETAKKPQDAKS
SMVLAICTRYLGKEDATMSILDIAMMTGFVPDTNDLELLSTGVDRYISKYELSKAFSNKN
TLIIYLDKISHSEEECLSFKIHQYFNVGLIQPGSVKVYSYYNLEETCTQFYHPDKEDGML
SKLCHKDLCRCAEENCFMQQEEEVTLNDRLDKACEPGVDYVYKTRLVRSELSEDFDEYVM
VVEQTIKSGSDEVQAGQERRFISHVKCREALKLQDGKHYLVWGLSSDLWGEKPNIRYIIG
KDTWVEIWPEAEECQDEENQKQCQDLGAFAESMVVFGCPN
Download sequence
Identical sequences ENSSTOP00000003111 ENSSTOP00000003111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]