SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003259 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003259
Domain Number 1 Region: 213-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000186
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003259   Gene: ENSSTOG00000003646   Transcript: ENSSTOT00000003640
Sequence length 288
Comment pep:known_by_projection scaffold:spetri2:JH393433.1:1366651:1369742:1 gene:ENSSTOG00000003646 transcript:ENSSTOT00000003640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGWDT
GFTDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDVPVK
EGYRGGLLKLEAADPYVESPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEI
KTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNEC
HTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRMGSRKLFLD
Download sequence
Identical sequences I3M2N4
ENSSTOP00000003259 ENSSTOP00000003259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]